PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT23170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 280aa    MW: 30200.9 Da    PI: 6.2705
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT23170genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv ++++ G+g+W++++   g+ R+ k+c++rw +yl
         EMT23170 14 KGPWTPEEDIILVSYIQENGPGNWRAVPINTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-21564IPR009057Homeodomain-like
PROSITE profilePS5129423.676965IPR017930Myb domain
SMARTSM007174.4E-121363IPR001005SANT/Myb domain
PfamPF002499.2E-151461IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-191588IPR009057Homeodomain-like
CDDcd001678.57E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.1E-56598IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIILVSYIQ ENGPGNWRAV PINTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF TTHEEGIIVH LQSLLGNSSA ETAANLPGAV HLDNHHHRYH HDAIAASSST  120
VDHGCYAACS NPEVTQQTTI TMRRSPFADV AADCSSSSYA SSMDNISRLL DGFMKSSPPT  180
ATDVKPNIAV VSDPFMSFDR MSGTGAGLAF ISGVPQQQQQ QPALMGGMSY DDEATGQQQQ  240
LHHQLPLCSI AKWLLDEAAG QGGDPMDLSD GGCSSLPLLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-14149827110MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3574780.0AK357478.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1054F12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977433.15e-93PREDICTED: transcription factor MYB30-like
TrEMBLM8BE300.0M8BE30_AEGTA; Myb-related protein 306
STRINGMLOC_68511.11e-152(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-60myb domain protein 60